DAFTAR PUSTAKA Abdallah F. 2000. A prediction of the size and evolutionary origin of the proteome of chloroplasts of Arabidopsis. Trends Plant Sci 5:141–142. Allard RW. 1960. Principles of Plant Breeding. New York: John Wiley and Sons. Inc. Allen JF, Forsberg J. 2001. Molecular recognition in thylakoid structure and function. Trends Plant Sci 6:317–326. Allen JF. 1995. Thilakoid protein phosphorilation, state 1-state 2 transition and photosytem stoichiomtry adjustment : redox control at multiple levels of gene expression. Plant Physiol 93:196-205. Alves de Alvarenga A, Castro M de E, Junior E de CLJ, Magalhaes MM. 2003. Effects of different light levels on the initial growth and photosyntesis of Croton urucurana Baill. in Southeastern Brazil. R Arvore Vicosa-MG 27:53-57. Anderson JM, Chow WS, Park YI. 1995. The grand design of photosynthesis acclimation of the photosynthetic apparatus to environmental cues. Photosynthesis Res 46:129-139. Anderson JM. 1986. Photoregulation of composition, function and structure of thylakoid membranes. Annu Rev Plant Physiol 33:93-136. Anderson JM. 2000. Strategies of photosynthetic adaptations and acclimation. Di dalam: Yunus M, Pathre U, Mohanty P, editor. Probing Photosynthesis. Mechanisms, Regulation and Adaptation. London: Taylor & Francis. hlm 284-291. Andersson J, Mentworth M, Walters RG, Howards CA, Ruban AV, Horton P, Janson S. 2003. Absence of the Lhcb1 and Lhcb2 proteins of the light harvesting complex of photosystem II – effects on photosynthesis, grana stacking and fitness. Plant J 35:350-361. Andersson J, Walters RG, Horton P, Janson S. 2001. Antisense inhibition the photosynthetic antenna proteins CP29 and CP26: implications for the mechanism of protective energy dissipation. Plant Cell 13:1193-1204. Andersson J. 2003. Dissecting the photosytem II light-harvesting antenna (disertation). Sweden: Umea University. Arnon DI. 1949. Cooper enzymes in isolated chloroplast, polyphenol oxidase in Beta vulgaris. Plant Physiol 24:1-15. Asadi B, Arsyad DM, Zahara H, Darmijati. 1997. Pemuliaan kedelai untuk toleran naungan. Buletin Agrobio 1:15-20. Asadi B, Arsyad DM. 1995. ”Pangrango” a new soybean variety for intercropping with maize. Food Legume Coarse Grain. Network Newsletter 33:15-18. Badan Penelitian dan Pengembangan Departemen Pertanian. 2005. Rencana Aksi Pemantapan Ketahanan Pangan 2005-2010. Lima Komoditas; Beras, Jagung, Kedelai, Gula, dan Daging Sapi. Jakarta: Balitbangtan Deptan. Baharsyah JS, Suhardi D, Las I. 1993. Hubungan iklim dengan pertumbuhan kedelai. Di dalam: Somaatmadja S, Ismunadji M, Sumarno, Syam M, Manurung SO, Yuswadi, editor. Kedelai. Bogor: Badan Penelitian dan Pengembangan Pertanian, Pusat Penelitian dan Pengembangan Tanaman. hlm 87-102.
Baharsyah JS. 1980. Pengaruh naungan pada berbagai tahap perkembangan dan populasi tanaman terhadap pertumbuhan, hasil dan komponen hasil kedelai (Glycine max (L.) Merr.). [disertasi], Bogor: Fakultas Pascasarjana, Institut Pertanian Bogor, Bogor. Bailey S, Horton P, Walter RG. 2004. Acclimation of Arabidopsis thaliana to the light environment: the relationship between photosynthetic function and chloroplast composition. Planta 218:793-802. Bailey S, Walter RG, Horton P. 2001. Acclimation of Arabidopsis thaliana to the light environment, the existense of separate low light and high light responses. Planta 213:794-801. Ballare CL. 1999. Keeping up with the neighbours: phytochrome sensing and other signalling mechanisms. Trends Plant Sci 4:97-102. Behera RK, Choudhury NK. 2001. Photosynthetic characteristics of chloroplast of primary wheat leaves grown under different irradiance. Photosynthesis 39:11-15. Ben-Shem A, Frolow F, Nelson N. 2003. The crystal structure of plant photosystem I. Nature 426:630–635. Biswal B, Biswal UC. 1999. Photosynthesis under stress: stress signals and adaptive response of chloroplast. Di dalam: Pessarakli, editor. Hand Book of Plant and Crop Stress. New York: Marcel Dekker, Inc. hlm 315-336. Biswal B. 1997a. Chloroplast metabolism during leaf greening and degreening. Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. New York: Marcel Dekker, Inc. hlm 71-81. Biswal B. 1997b. Chloroplast, pigments, and molecular responses of photosiynthesis under stress. Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. New York: Marcel Dekker, Inc. hlm 877-885. Bjorkman O. 1981. Responses of different quantum flux densities. Di dalam: Lange OL, Nobel PS, Osmond CB, Ziegler H, editor. Physiological Plant Ecology. I. Responses to the physical environment. Encycl Plant Physiol New Series. Vol 12A. Berlin:Springer-Verlag. hlm 57-107. Bruggeman W, Danborn B. 1993. Longterm chilling of young tomato plants under low light. III. Leaf development as reflected by photosynthesis parameters. Plant Cell Physiol 73:507-510 Bultynck L, Lambers H. 2004. Effects of applied gibberellic acid and paclobutrazol on leaf expansion and biomass allocation in two Aegilops species with contrasting leaf elongation rates. Physiologia Plantarum 122:143–151. Burns GW. 1976. The Science of Genetics: An Introduction to Heredity. Ed ke-3. New York: Macmillan Publ. Co. Inc. Burton GW. 1951. Quantitative inheritance in pearl millet (Pennisetum glaucum). Agron J 43:409-417. Carabelli M, Morelli G, Whitelam G, Ruberti I. 1996. Twilight-zone and canopy shade induction of the Athb-2 homeobox gene in green plants. Proc Natl Acad Sci USA 93: 3530–3535. Castle WE. 1921. An improved method of estimating the number of genetic factors concerned in case of blending inheritance. Sci 54:223.
132
Chahal GS, Gosal SS. 2003. Principles and Procedures of Plant Breeding. Biotechnological and Conventional Approaches. New Delhi: Narosa Publishing House. Chaturvedi GS, Ingram KT. 1989. Growth and yield of lowland rice in response to shade and drainage. Philippine J. Crop Sci 14:61-67. Chaturvedi GS, Ram PC, Singh AK, Ram P, Ingram KT, Singh BB, Singh RK, Singh VP. 1994. Carbohydtrate status of rainfed lowland rices in relation to submergence, drought and shade tolerance. Di dalam: Lucknow VP, editor. Physiology of Stress Tolerance in Rice. India-IRRI Philippines. hlm 104122. Chowdury PK, Thangraj M, Jayapargasam. 1994. Biochemical changes in lowirradiance tolerant and susceptable rice cultivars. Biol Plantarum 36:237242. Chozin MA, Sopandie D, Sastrosumajo S, Sumarno. 1999. Physiology and Genetic of Uplanad Rice adaptation to shade. Final Report of Graduate Tem Research Grant, URGE Project. Directorate General of Higher Education, Ministry of Education and Culture. Claverie J-M, Notredame C. 2003. Bioinformatics for Dummies. Indiana: Wiley Publishing, Inc. Critchley C. 1997. The structure and function of photosystem II. Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. New York: Marcel Dekker, Inc. hlm 231-240. Crowder LV. 1993. Genetika Tumbuhan. Terjemahan Lilik K dan Soetarso. Cetakan ke 4. Yogyakarta: Gadjah Mada University Press. Dale JW, von Schantz M. 2002. From Genes to Genomes. Concepts and Applications of DNA Technology. New York: John Wiley & Sons. de la Torre WR, Burkey KO. 1999. Acclimation of barley to changes in light intensity: photosynthetic electron transport activity and components. Photosynthesis Res 24:117-125. Degenhardt J, Tobin EM. 1996. A DNA binding activity for one of two closely defined phytochrome regulatory elements in an Lhcb promoter is more abundant in etiolated than in green plants. Plant Cell 8: 31-41 Devlin PF, Yanovsky MJ, and Kay SA. 2003. A genomic analysis of the shade avoidance response in Arabidopsis. Plant Physiol 133:1617-1629. dos Santos. 2004. Basic bioinformatic applications for microbiologists. Braunschweig: GBF. Dunford DG, Falkowski PG. 1997. Chloroplast redox regulation of nuclear gen transcription during photoacclimation. Photosynth Res 53:229-241. Escoubas J-M, Lomas M, Laroche J, and Falkowski PG. 1995. Plant Biology Light intensity regulation of cab gene transcription is signaled by the redox state of the plastoquinone pool. Proc Natl Acad Sci 92:10237-10241. Escoubas J-M, Lomast M, Laroche J, Falkowski PG. 1995. Light intensity regulation of cab gene transcription is signaled by the redox state of the plastoquinone pool. Proc Natl Acad Sci USA 92:10237-10241. Evans JR, Poorter H. 2001. Photosynthetic acclimation of plants to growth irradiance: the relative importance of specific leaf area and nitrogen partitioning in maximizing carbon gain. Plant Cell Environ 24:755-767.
133
Evans JR. 1987. The relationship between electron transport components and photosynthetic capacity in pea leaves grown at different irradiances. Aust J Plant Physiol 15:93-106. Evans JR. 1988. Aclimation by the thylakoid membranes to growth irradiance and partitioning of nitrogen between soluble and thylakoid protein. Aust J Plant Physiol 15:93-106. Fehr WR. 1987. Principle of Cultivar Development. Theory and Technique. Vol. 1. New York: MacMillan Pub. Co. Fey V, Wagner R, Bräutigam K, Pfannschmidt T. 2005. Photosynthetic redox control of nuclear gene expression. J Exp Bot 56:1491-1498. Franklin KA, Praekelt U, Stoddart WM, Billingham OE, Halliday KJ, Whitelam GC. 2003. Phytochromes B, D, and E act redundantly to control multiple physiological responses in Arabidopsis. Plant Physiol 131:1340–1346. Garczarek L, Hess WR, Holtzendorff J, van der Staay GWM, Partensky F. 2000. Multiplication of antenna genes as a major adaptation to low light in a marine prokaryote. PNAS Early Edition 1- 4 Grami B, Baker RJ, Stefansson BR. 1977. Genetics of protein and oil content in summer rape: heritability, number of effective factors, and correlations. Can J Plant Sci 57:937-943. Grant RH. 1997. Partitioning of biologically active radiation in plant canopies. Int J Biometeorol 40:26-40. Gyula N, Schafer E, Nagy F. 2003. Light perception and signalling in higher plants. Curr Opin Plant Biol 6:446-452. Hachtel W. 1997. DNA and gene expression in photosynthetic plastids (chloroplasts). Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. New York: Marcel Dekker, Inc. hlm 331-348. Hale MG, Orchut DM. 1987. The Physiology of Plants Under Stress. New York: John Wiley and Sons. Hall DO, Rao KK. 1987. Photosynthesis. Studies in Biology. Cambridge: University Press. Hall TA. 1999. BieEdit: a user friendly biological sequence alignment editor and analysis pogram for Window 95/98/NT. Nucl Acids Symp Ser 41:95-98. Halloran GM, Knight R, McWhirter KS, Sparrow DHB. 1979. Plant Breeding. Brisbane: Australian Vice-Chancellors Committee. Handayani T. 2003. Pola pewarisan sifat toleran terhadap intensitas cahaya rendah pada kedelai (Glycine max L. Merr) dengan penciri spesifik karakter anatomi, morfologi dan molekuler [disertasi]. Bogor: Program Pascasarjana, Institut Pertanian Bogor. Haris A. 1999. Karakteristik iklim mikro dan respon tanaman padi gogo pada pola tanam sela dengan tanaman karet [thesis]. Bogor: Program Pascasarjana, Institut Pertanian Bogor. Heck DA, Miles D, Chitnis PR. 1999. Characterization of two photosynthetic mutants of maize. Plant Physiol 120:1129–1136. Hidema J, Makino A, Kurita Y, Mae T, Ohjima K. 1992. Changes in the level of chlorophyll a/b protein of PSII in rice leaves agent under different irradiances from full expansion through senescense. Plant Cell Physiol 33: 1209-1214.
134
Hiyama T. 1997. Fotosystem I: Structures and Functions. Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. New York: Marcel Dekker, Inc. hlm 195-218. Horton P, Ruban AV, Walters RG. 1996. Regulation of light harvesting in green plants. Annu Rev Plant Physiol Plant Mol Biol 47:655-684 Horton P. 2000. Prospects for crop improvement through the genetic manipulation of photosynthesis: morphological and biochemical aspects of light capture. J Exp Bot 51:475-485. Howell SH. 1998. Molecular Genetics of Plant Development. Cambridge, UK: Cambridge University Press. Hudson GS, Evan JR, Caemmerer SV, Arvidson YBC, Andrews TJ. 1992. Reduction of ribulose-1,5-bisphosphate carboxylase/oxygenase content by antisense RNA reduces photosynthesis in transegenic tobacco plants. Plant Physiol 98:294-302. Jansson S. 1999. A guide to the Lhc genes and their relatives in Arabidopsis. Trends Plant Sci 4: 236-240. Jarvis P, Soll J. 2001. Toc, Tic, and chloroplast protein import. Biochim Biophys Acta 1541:64–79. Jiao DM, Tong HY, Zhang JX. 1993. Identification of photosynthetic characteristics adapted to wide range of light intensities in rice varieties. Chinese J Rice Sci 7:243-246. Jones HG. 1992. Plant and Microclimate. A Quantitative Approach to Environmental Plant Physiol. 2nd edition. Cambridge University Press. Jordan P. 2001. Three-dimensional structure of cyanobacterial photosystem I at 2.5 Å resolution. Nature 411:909–917. Joshi AK. 1997. Genetic factors affecting photosinthesis. Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. New York: Marcel Dekker, Inc. hlm 751-762. Jufri A. 2006. Mekanisme adaptasi kedelai terhadap cekaman intensitas cahaya rendah [disertasi]. Bogor: Sekolah Pascasarjana Institut Pertanian Bogor. Juraimi AS, Drennan DSH, Anuar N. 2004. The effects of shading on the growth, development and partitioning of biomass in bermudagrass (Cynodon dactylon (L.) Pers). J Biol Sci 4:756-762. Kahl G. 2001. The Dictionary of Gene Technology. Ed ke-2. New York: WileyVCH. Kassam AH. 1978. Agro-climatic suitability assesment of rainfed crops in African by growing period zones. FAO Kephart KD, Buxton DR, Taylor SE. 1992. Growth of C3 and C4 perenial grasses in reduced irradiance. Crop Sci 32:1033-1038. Khumaida N, Sopandie D, Takano T. 2001. Adaptability of soybean to shade stress: Expression of photosynthetic genes in soybean genotypes. Di dalam: Proceeding of the 1st Seminar Toward Harmonization between Development and Environmental Conservation in Biological Production. Tokyo University, February 21-23, 2001. Khumaida N. 2002. Studies on adaptability of soybean and upland rice to shade stress [dissertation]. Tokyo: The University of Tokyo.
135
Kim Gyung-Tae, Yano S, Kozuka T, Tsukaya H. 2005. Photomorphogenesis of leaves: shade-avoidance and differentiation of sun and shade leaves. Photochem Photobiol Sci 4:170-174. Klukas O, Schubert Wolf-Dieter, Jordan P, Krauß N, Fromme P, Witt HT, Saenger W. 1999. Photosystem I, an improved model of the stromal subunits PsaC, PsaD, and PsaE. J Biol Chem 274: 7351-7360. Krapp A, Chaves MM, David MM, Rodriguez ML, Pereira JS, Stitt M. 1994. Decreased ribulose-1,5-bisphosphate carboxylase/oxygenase in transgenic tobacco transformed with "antisense" rbcS. VIII. Impact on photosynthesis and growth in tobacco growing under extreme high irradiance and high temperature. Plant Cell Environ 17:945-953. Kraub N, Saenger W. 2001. Photosystem I. Encyclopedia Of Life Sciences. Nature Publishing Group / www.els.net. Kruip J, Chitnis PR, Lagoutte B, Ro¨gner M, Boekema EJ. 1997. Structural organization of the major subunits in cyanobacterial photosystem 1. Localization of subunits PsaC, -D, -E, -F, AND –J. J Biol Chem 272:17061– 17069. Kulandaevilu G, Lingakumar K. 2000. Molecular targets of UV-B radiation in the photosynthetic membranes. Di dalam: Yunus M, Pathre U, Mohanty P, editor. Probing Photosynthesis. Mechanisms, Regulation and Adaptation. London: Taylor & Francis. hlm 364-377. Lagoutte B, Hanley J, Bottin H. 2001. Multiple functions for the C terminus of the PsaD subunit in the cyanobacterial photosystem I complex. Plant Physiol 126:307-316. Larsson UK, Anderson JM. 1987. Variation in relative content of the pheripheral and inner light-harvesting chlorophyll a/b-protein complex (LHC-II) subpopulations during thylakoid light adaptation and development. Biochem Biophys Acta 894:69-75. Lautt BS, Chozin MA, Sopandie D, Darusman LK. 2000. Perimbangan Patisukrosa dan aktivitas enzim sukrosa fosfat sintase pada padi gogo yang toleran dan peka terhadap naungan. Hayati 7:31-34. Lautt BS. 2003. Fisiologi toleransi padi gogo terhadap naungan: tinjauan karakteristik fotosintesis dan respirasi [disertasi]. Bogor: Sekolah Pascasarjana, Institut Pertanian Bogor. Lawlor DW. 1987. Photosynthesis: Metabolism, Control and Physiology. Singapore: Longman Singapore Publisher Ltd. Leong TY, Anderson JM. 1984. Adaptation of the thylakoid membranes of pea chloroplasts to light intensity II. Study on the distribution of chlorophyllprotein complexes. Photosynthesis Res 5:105-115. Lestari T. 2005. Adaptasi kedelai terhadap intensitas cahaya rendah melalui pendekatan analisis isozim [thesis]. Bogor. Sekolah Pascasarjana Institut Pertanian Bogor. Levitt J. 1980. Responses of Plants to Environmental Stress. Ed ke-2. New York: Academic Press. Li S, Showalter AM. 1996. Cloning and developmental/stress-regulated expression of a gene encoding a tomato arabinogalactan protein. Plant Mol Biol 32:641–652.
136
Li Y, Yan H, Zhou B, Kawabata S, Sakiyama R. 1999. Role of Chalcone Synthase and Dihydroflavonol Reductase in Light Dependent Accumulation of Anthocyanins in 'Toyonoka' Strawberry Fruits. www.paper.edu.cn Lichtenthaler HK, Burkart S. 1999. Photosynthesis and high light stress. Bulg J Plant Physiol 25:3-16. Lindahl M, Yang DH, Anderson B. 1995. Regulatory proteolysis of the major light harvesting chlorophyll a/b binding protein of photosynthesis II by a light induced membrane associated enzymatic system. Eur J Biochem 231:503-509. Lodato P, Alcaíno J, Barahona S, Retamales P, Jiménez A, Cifuentes V. 2004. Study of the expression of carotenoid biosynthesis genes in wild-type and deregulated strains of Xanthophyllomyces dendrorhous (Ex. Phaffia rhodozyma). Biol Res 37:83-93. Lu C, Koroleva OA, Farrar JF, Gallagher J, Pollock CJ, Tomos AD, 2002. Rubisco Small Subunit, Chlorophyll a/b-binding protein and sucrose:fructan-6-fructosyl transferase gene expression and sugar status in single barley leaf cells in situ. cell type specificity and induction by light. Plant Physiol 130:1335-1348. Luciński R, Jackowski G. 2006. The structure, functions and degradation of pigment-binding proteins of photosystem II. Acta Biochimica Polonica 53: 693-708 Lynn D. 2005. Introduction to Bioinfomatics. International Livestock Research Institute, Kenya. http://www.binf.org/ILRI2005/ Ma L, Li J, Qu L, Hager J, Chen Z, Zhao H, Deng XW. 2001. Light control of Arabidopsis development entails coordinated regulation of genome expression and cellular pathways. Plant Cell 13: 2589-2607 Makino A, Mae T, Ohira K. 1984. Relation between nitrogen and riboluse-1,5bisphosphate carboxylase in rice leaves from emergence through senescene. Plant Cell Physiol 25:249-437. Makino A, Mae T, Ohira K. 1985. Photosynthesis and riboluse-1,5 bisphosphate carboxylase/oxygenase in rice leaves from emergence through senescence. Quantitative analysis by carboxylation/oxygenation and regeneration of ribulose-1,5 bisphosphate. Planta 166:414-420 Malkin R, Niyogi K. 2000. Photosynthesis. Di dalam Buchanan BB, Gruissem W, Jones RL, editor. Biochemistry & Molecular Biology of Plants. Rockville, Maryland: American Society of Plant Physiologists. hlm 568-628. Masuda T, Tanaka A, Melis A. 2002. Chlorophyll antenna size adjustments by irradiance in Dunaliella salina involve coordinate regulation of chlorophyll a oxygenase (CAO) and Lhcb gene expression. Proceed 2002 U.S. DOE Hydrogen Program Review Maxwell KL, Joanne LM, Rachel ML, Howard G, Peter H. 1999. Chloroplast acclimation in leaves Guzmania monostachia in response to high light. Plant Physiol 121:89-95 McNellis TW, Deng X-W. 1995. Light control of seedling morphogenetic pattern. Plant Cell 7:1749-1761. McWhirter KS. 1979. Breeding of Cross-Pollinated crops. Di dalam: Halloran GM, Knight R, McWhirter KS, Sparrow DHB, editor. Plant Breeding. Australian Vice-Chancellors Committee Brisbane. 255p
137
Melis A. 1991. Dynamics of photosynthetic membrane composition and function. Biochim Biophys Acta 1058: 87-106 Mohr H, Scoopfer. 1995. Plant Physiology. Translated by Gudrun and DW Lawlor. Springer. Morelli G, Ruberti I. 2002. Light and shade in the photocontrol of Arabidopsis growth. Trends Plant Sci, 7:399-404. Mostowska A. 1997. Enviornmental factors affecting chloroplasts. Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. Marcel Dekker, Inc. New York. hlm 407-424. Mount DW. 2001. Bioinformatics: Sequence and Genome Analysis. New York: Cold Spring Harbor Laboratory Press. Muhuria L. 2007. Mekanisme fisiologi dan pewarisan sifat toleransi kedelai (Glycine max L. Merrill) terhadap intensitas cahaya rendah [disertasi]. Bogor: Program Pascasarjana, Institut Pertanian Bogor. Murata N, Loss DA. 1997. Membrane fluidity and temperature perception. Plant Physiol 115:875-879 Murchie EH, Hubbart S, Chen Y, Peng S, Horton P. 2002. Acclimation of rice photosynthesis to irradiance under field conditions. Plant Physiol 130:19992010 Murty KS, Dey SK, Swain P, Baig MJ. 1992. Low light adapted restorers of different maturity durations for hybrid rice breeding. Int Rice Res Newsletter 17:6-7. Murty KS, Suhu G. 1987. Impact of low light stress on growth and yield of rice. Di dalam: Dey SK, Baig MJ, editor. Weather and Rice. Proceeding International workshop on impact of weather parameters on growth and yield of rice. IRRI. Los Banos. Phillippines. hlm 94-100. Nagata N, Tanaka R, Satoh S, Tanaka A. 2005. Identification of vinyl reductase gene for chlorophyll synthesis in Arabidopsis thaliana and implications for the evolution of Prochlorococcus species. Plant Cell 17:233-240 Nasoetion AH, Barizi. 1973. Metode Statistika untuk penarikan kesimpulan. Departemen Statistika dan Komputasi. Fakultas Pertanian IPB. Neidhardt J, Benemann JR, Zhang L, Melis A. 1998. Photosystem II repair and chloroplast recovery from irradiance stress: relationship between chronic photoinhibition, light-harvesting chlorophyll antenna size and photosynthetic productivity in Dunaliella salina (green algae). Photosynth Res 56:175-184. Nelson N, Ben-Shem A. 2002. Photosystem I reaction center: past and future. Photosyth. Res. 73:193–206 Nelson N, Ben-Shem A. 2004. The complex architecture of oxygenic photosynthesis. Molecular Cell Biol, 5:1-12 Nicot N, Hausman J-F, Hoffmann L, Evers D. 2005. Housekeeping gene selection for real-time RT-PCR normalization in potato during biotic and abiotic stress. J Exp Bot, 56:2907-2914. Nilsen ET, Orcutt DM. 1996. The physiology of Plant Under Stress. Abiotic Factors. John Wiley & Sons. Inc, New York. Niquist WE. 1991. Estimation of heritability and prediction of selection response in plant populations. Critical Reviews in Plant Sciences, 10:235-322.
138
Obokata J, Mikami K, Hayashida N, Nakamura M, Sugiura M. 1993. Molecular Heterogeneity of Photosystem I (psaD, psaE, psaF, psaH, and psaL Are All Present in Isoforms in Nicotiana spp. Plant Physiol. 120: 1129–1136 Oh SK, Han KH, Ryu SB, Kang H. 2000. Molecular Cloning, Expression, and Functional Analysis of a cis-Prenyltransferase from Arabidopsis thaliana. J Biol Chem 275:18482–18488 Okada K, Yasunori I, Kazuhiko S, Tadahiko M, Sakae K. 1992. Effect of light on degradation of chlorophyll and proteins during senescence of detaches rice leaves. Plant Cell Physiol 33:1183-1191. Ouellette AJA, Barry BA. 2002. Tandem mass spectrometric identification of spinach Photosystem II light-harvesting components. Photosynthesis Research 72: 159–173 Pandini F, Vello NA, de Almeida Lopes AC. 2002. Heterosis in soybeans for seed yield components and associated traits. Brazilian Archives Biology and Technology 45:401-412 Park Y-I, Chow WS, Anderson JM. 1996. Chloroplast movement in the shade plant Trandescantia albiflora helps protect photosystem II against light stress. Plant Physiol. 111:867-875 Pattanayaka, GK, Biswal AK, Reddy VS, Tripathy BC. 2005. Light-dependent regulation of chlorophyll b biosynthesis in chlorophyllide a oxygenase overexpressing tobacco plants. Biochem and Biophysic Res Commun 326: 466–471 Peters JL, Szell M, Kendrick RE. 1998. The expression of light-regulated genes in the high-pigment-1 mutant of tomato. Plant Physiol 117:797-807. Petr FC, Fery KJ. 1966. Genotypic correlation, dominance, and heritability of quantitative characters in oats. Crop Sci 6:259-262 Pfannschmidt T, Allen JF, Oelmüller R. 2001. Principles of redox control in photosynthesis gene expression. Physiol Plant 112: 1-9 Pfannschmidt T. 2003. Chloroplast redox signals: how photosynthesis controls its own genes. TRENDS in Plant Sci, 8: 33-41 Poehlman JM, Sleper DA. 1995. Breeding Field Crops. 4th edition. Iowa State University Press. 494p. Poespodarsono S. 1988. Dasar-dasar Pemuliaan Tanaman. Pusat Antar Universitas IPB. Bogor. Portis AR. 1992. Regulation of ribulose1,5 bisphosphate carboxylase/oxygenase activity. Annu Rev Plant Physiol Plant Mol Biol 43:415-437 Portis AR. 1995. The regulation of rubisco by rubisco activase. J Exp Bot 46:1285-1291. Quail PH. 2002. Photosensory perception and signalling in plant cells: new paradigms? Current Opinion Cell Biol, 14:180-188. Race HL. 1999. Why have organelles retained genomes? Trends Genet. 15:364– 370 Richardson, AD, Duigan SP, Berlyn GP. 2002. An evaluation of noninvasive methods to estimate foliar chlorophyll content. New Phytol. 153:185–194. Richter M, Ruhle W, Wild A. 1990. Studies on the mechanism of photosystem II photoinhibition. II. The involement of toxic oxygen species. Photosynth. Res. 24:237-243.
139
Rochaix JD. 2001. Post-transcriptional control of chloroplast gene expression. From RNA to photosynthetic complex. Plant Physiol 125:142–144. Roy D. 2000. Plant Breeding. Analysis and Exploitation of Variation. Narosa Publishing House. New Delhi. 701p Salisbury FB, Ross CW. 1992. Plant Physiology. 4th edition. Wadsworth Pub. Co Salvucci ME, Ogren WL. 1996. The mechanism of rubisco activase: in sight from studies of the properties and the structure of the enzyme. Photosynthetic Res 47:1-11 Sato-Nara K, Demura T, Fukuda H. Expression of photosynthesis-related genes and their regulation by light during somatic embryogenesis in Daucus carota. Planta. 219: 23–31 Scheller HV, Jensen PE, Haldrup A, Lunde C, Knoetzel J. 2001. Role of subunits in eukaryotic photosystem I. Biochim. Biophys. Acta, 1507:41–60. Shapiro SS, Wilk MB. 1965. An analysis of variance test for normality (complete sample). Biometrika 52:591-611 Sinclair TRR, Torie. 1989. Leaf nitrogen, photosynthesis and crop radiation use efficiency. Crop Sci 29:90-98. Sopandie D, Chozin MA, Khumaida N, Takano T. 2001. Differential shading tolerance of upland rice genotypes related to rubisco activity and its gene expression. Di dalam: Proceeding of the 1st Seminar Toward Harmonization between Development and Environmental Conservation in Biological Production. Tokyo University, February 21-23, 2001. Sopandie D, Chozin MA, Sastrosumajo S, Juhaeti T, Sahardi. 2003b. Toleransi terhadap naungan pada padi gogo. Hayati 10:71-75. Sopandie D, Chozin MA, Tjitrosemito S, Sahardi. 2003c. Keefektifan uji cepat ruang gelap untuk seleksi ketenggangan terhadap naungan pada padi gogo. Hayati 10:91-95. Sopandie D, Trikoesoemaningtyas, Handayani T, Jufri A, Takano T. 2003a. Adaptability of soybean to shade stress: Identification of morphological responses. Di dalam: Proceeding of the 2nd Seminar Toward Harmonization between Development and Environmental Conservation in Biological Production. Tokyo University, Tokyo, February 15-16, 2003. Sopandie D, Trikoesoemaningtyas, Khumaida N. 2005. Fisiologi, genetik, dan molekuler adaptasi kedelai terhadap intensitas cahaya rendah: Pengembangan varietas unggul kedelai sebagai tanaman sela. Laporan th II Penelitian Hibah Penelitian Tim Pascasarjana-HPTP Angkatan II Tahun 2004-2006. Dirjen Dikti Depdiknas. Sopandie D, Trikoesoemaningtyas, Sulistyono E, Heryani N. 2002. Pengembangan kedelai sebagai tanaman sela: Fisiologi dan pemuliaan untuk toleransi terhadap naungan. Laporan Penelitian Hibah Bersaing, Direktorat Jenderal Pendidikan Tinggi. Sopandie D. 2006. Perspektif Fisiologi dalam Pengembangan Tanaman Pangan Di Lahan Marjinal. Orasi Ilmiah Guru Besar Tetap Fisiologi Tanaman. Fakultas Pertanian Institut Pertanian Bogor, 16 September 2006. Soverda N. 2002. Karakteristik fisiologi fotosintesis dan pewarisan sifat toleran naungan pada padi gogo [disertasi]. Bogor: Program Pascasarjana, Institut Pertanian Bogor.
140
Staub JM, Deng XW. 1996. Light signal transduction in plants. Photochem Photobiol 64: 897-905 Steindler C, Matteucci A, Sessa G, Weimar T, Ohgishi M, Aoyama T, Morelli G, Ruberti1 I. 1999. Shade avoidance responses are mediated by the ATHB-2 HD-Zip protein, a negative regulator of gene expression. Development 126:4235-4245 Stern DB. 1997, Transcription and translation in chloroplasts. Trends Plant Sci. 2:308–315 Sulistyono E, Sopandie D, Chozin MA, Suwarno. 1999. Adaptasi padi gogo terhadap naungan: Pendekatan Morfologi dan Fisiologi. Comm Ag 4:62-68 Surpin M, Larkin RM, Chory J. 2002. Signal transduction between the chloroplast and the nucleus. Plant Cell, s323-s338 Susek RE, Chory J. 1992. A tale of two genomes: Role of a chloroplast signal in coordinating nuclear and plastid genome expression. Aust J Plant Physiol 19:387-399 Taiz L, Zeiger E. 2002. Plant Physiology. Sinauer Associates, Inc., Pub. Sunderland, Massachusetts Tanaka R, Koshino Y, Sawa S, Ishiguro S, Okada K, dan Tanaka A. 2001. Overexpression of chlorophyllide a oxygenase (CAO) enlarges the antenna size of photosystem II in Arabidopsis thaliana. Plant J 26:365– 373 Taylor WC. 1989. Regulatory interactions between nuclear and plastid genomes. Annu Rev Plant Physiol Plant Mol Biol 40:211-233 Thorne JH, Koller HR. 1974. Influence of assimilate demand on photosynthesis, diffusive resistance, translocation, and carbohydrate level of soybean leaves. Plant physiol 54:201-2-7 Ting CS, Rocap G, King J, Chisholm SW. 2002. Cyanobacterial photosynthesis in the oceans: the origins and significance of divergent light-harvesting strategies.Trends Microbiol 10:134-142 Trebst A. 1995. Dinamics in photosystem II structure and function. P3-16. Di dalam: Schulze E-D, Caldwell MM, editor. Ecophysyiology of Photosynthesis. Springer.New York. Trikoesoemaningtyas, Sopandie D, Takano T. 2003. Genetic and breeding of soybean for adaptation to shade stress. Di dalam: Proceeding of the 2nd Seminar Toward Harmonization between Development and Environmental Conservation in Biological Production. Tokyo University, Tokyo, February 15-16, 2003 Tyagi AK, Dhingra A, Raghuvanshi. 2000. Light-regulated expression of photosynthesis-related genes. Di dalam: Yunus M, Pathre U, Mohanty P. editor. Probing Photosynthesis. Mechanisms, regulation and adaptation. Taylor & Francis. London. hlm 324-341. Tyas KN. 2006. Adaptasi kdelai terhadap intensitas cahaya rendah melalui efisiensi penangkapan cahaya. [Tesis]. Sekolah Pascasarjana IPB, Bogor. Vandenbussche F, Pierik R, Millenaar FF, Voesenek LACJ, Van Der Straeten D. 2005. Reaching out of the shade. Current Opinion in Plant Biol, 8:462–468
141
Vander Loo FE, Salvuchi ME. 1996. Activation of ribulose-1,5 bisphosphate carboxylase/oxygenase (rubisco) involves Rubisco activase. Biochem 35:8143-8148 Vijayalaksmi C, Radhakrishnann R, Nagarajam M, Rajendram C. 1991. Effect of solar radiation deficit on rice productivity. J Agron Crop Sci 167:184-187 Vogelmann TC, Martin G. 1993. The functional significance of palisade tissue: Penetration of directional versus diffuse light. Plant Cell Environ 16:65-72 Wallace DH, Baudoin JP, Beaver J, Coyne DP, Halseth DE, Masaya PN, Munger HM, Myers JR, Silbernagel M, Yourstone KS, Zobel RW. 1993. Improving efficiency of breeding for higher crop yield. Theo Appl Genet, 86:27-40. Walter RG, Horton P. 1994. Acclimation of Arabidopsis thaliana to the light environment: Changes in composition of photosynthetic apparatus. Planta, 195:248-256 Walter RG, Horton P. 1995. Acclimation of Arabidopsis thaliana to the light environment: regulation of chloroplast composition. Planta, 197:475-481 Walter RG, Rogers JJM, Shephard F, Horton P. 1999. Acclimation of Arabidopsis thaliana to the light environment: the role of photoreseptors. Planta, 209:517-527 Warner JN. 1952. A method for estimating heritability. Agron.J. 44:427-430 Watanabe N, Fuji C, Shirota M, Furuta Y. 1993. Changes in chlorophyll, thyllakoid proteins and photosynthetic adaptation to sun and shade environments in diploid and tetraploid Oryza eicingeri Peter. Plant Physio. Biochem 31:469-474 Weaver LM, Amasino RM 2001. Senescence is induced in individually darkened Arabidopsis leaves, but inhibited in whole darkened plants. Plant Physiol. 127:876-886 Webb MR, Melis A. 1995. Chloroplast response in Dunaliella salina to irradiance stress: effect on thylakoid membrane protein assembly and function. Plant Physiol 107: 885-893. Webber AN, Lee H, Bingham SE. 1997. Structure and function of fotosystem I: a molecular approach. Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. Marcel Dekker, Inc. New York. hlm 219-230. Welsh JR. 1991. Dasar-dasar Genetika dan Pemuliaan Tanaman. Terjemahan Mogea JP. Penerbit Erlangga Jakarta. 224h Weston E, Thorogood K, Vinti G, Lopez-Juez E. 2000. Light quantity controls leaf-cell and chloroplast development in Arabidopsis thaliana wild type and blue-light-perception mutants. Planta, 211:807-815 Whitelegge JP. 1997. Covalent modification of photosystem II reaction center polypeptides. P241-256. Di dalam: Pessarakli, editor. Hand Book of Photosinthesis. Marcel Dekker, Inc. New York Xia Z, Broadhurst RW, Laue ED, Bryant DA, Golbeck JH, Bendall DS, 1998. Structure and properties in solution of PsaD, an extrinsic polypeptide of photosystem I. Europ J Biochem. 255: 309-316 Yeo AR. 1994. Physiology Criteria in Screening and Breeeding. Di dalam: Yeo AR, Howers TJ, editor. Soil Mineral Stresses: Approach to Crop Improvement. Springer-Verlag. Berlin. Yusuf M. 2001. Genetika I Struktur & Ekspresi Gen. CV. Sagung Seto, Jakarta. 300h
142
Ziemienowicz A, Gabrys H. 2003. From light to genes: phytochromes shuttle into and out of the nucleus. The ELS gazette. E-magazene of the European Life Scientist Organization, issue 13:1-5 Zou JW, Sun MX, Yang HY. 2002. Single-Embryo RT-PCR Assay to Study Gene Expression Dynamics During Embryogenesis in Arabidopsis thaliana. Plant Mol Biol Reporter 20: 19–26
143
Lampiran 1 Analisis Kandungan klorofil (mg/g berat basah sampel).
Analisis kandungan klorofil a, b, dan klorofil total dilakukan menggunakan metode yang digunakan Richardson et al. (2002) yang merupakan perbaikan metode yang digunakan Arnon (1949) sebagai berikut: - Disiapkan tiga disk sampel daun segar atau 100 mg berat basah, kemudian dimasukkan ke dalam tabung reaksi yang berisi 4.5 ml dimethyl sulfoxide (DMSO). - Sampel tersebut kemudian diinkubasi pada suhu 65oC selama 45 menit, dihindari penguapan untuk mencegah berkurangnya volume ekstrak. - Setelah dingin, larutan ekstrak diukur menggunakan spektrofotometer pada panjang gelombang 645 nm dan 663 nm. - Kandungan klorofil a, klorofil b dan klorofil total dihitung menggunakan rumus Arnon (1949) kemudian dikonversikan menjadi kandungan klorofil daun (mg klorofil/g berat basah sampel), sebagai berikut.
Klorofil A =
(12 .7 A 663 − 2 .69 A 645 ) Volume Berat
Klorofil B =
Klorofil
( 22 . 9 A 645 − 4 . 68 A 663 ) Volume Berat
Total
=
( 20 . 2 A 645 + 8 . 02 A 663 ) Volume Berat
dimana: volume = volume larutan ekstrak DMSO yang digunakan, dan berat = berat basah sampel daun (gram).
144
Lampiran 2 Penampilan warna daun beberapa genotipe kedelai pada berbagai intensitas cahaya rendah Genotipe kedelai
Intensitas cahaya rendah Ceneng
Godek
Pangrango
Slamet
Cahaya penuh (L0)
5 hari naungan (L1)
5 hari gelap total (L2)
3 hari naungan + 5 hari cahaya (L3) 3 hari naungan + 3 hari cahaya + 5 hari gelap total (L4)
145
Lampiran 3 Diskripsi varietas Pangrango Nomor galur : B8306-4-4 Asal : Persilangan varietas local Lampung x Davros (1983) Warna hipokotil : Ungu Warna bunga : Ungu Warna biji : Kuning Warna hilum biji : Coklat Warna kulit polong masak : Coklat Warna bulu : Coklat Tipe tumbuh : Diterminate Tinggi tanaman : ± 65 cm Jumlah cabang : 3-4 batang Umur mulai berbunga : ± 40 hari Umur polong masak : ± 88 hari Bentuk biji : Bulat – agak bulat Bobot 100 biji : ± 10 gram Ukuran biji : Sedang Kandungan lemak : ± 18% Kandungan protein : ± 39% Hasil pada tumpangsari dengan jagung tertinggi : ± 2.0 ton/ha rata-rata : ± 1.4 ton/ha Ketahanan terhadap penyakit : Tahan karat daun Pemulia : Asadi, Darman M. Arsyad, Sumarno, Hafni Zahara, dan Nurwita Dewi Tahun di lepas : 1995
146
Lampiran 4 Diskripsi varietas Slamet Nomor asal : T33 (UNSOED) Asal : Hasil persilangan Dempo x Wilis Warna hipokotil : Ungu Warna epikotil : Ungu Warna daun : Hijau Warna biji : Kuning Warna kulit polong masak : Coklat Warna bulu : Coklat Tipe tumbuh : Diterminate Tinggi tanaman : ± 65 cm Umur mulai berbunga : ± 37 hari setelah tanam Umur polong masak : ± 87 hari setelah tanam Kerabahan : Tahan Bobot 100 biji : ± 12.5 gram Kandungan lemak : ± 15% Kandungan protein : ± 34% Rata-rata hasil : ± 2.26 ton/ha Ketahanan terhadap penyakit : Agak tahan terhadap penyakit karat daun Keterangan : Sesuai untuk tanah masam Pemulia : Sunarto, Noor Farid, dan Suwarto Tahun di lepas : 1995
147
Lampiran 5 Sekuen lengkap gen JJ3 di database publik di GenBank LOCUS DEFINITION
EF628505 800 bp mRNA linear PLN 29-MAY-2007 Glycine max photosystem I subunit PsaD (psaD) mRNA, complete cds; chloroplast. ACCESSION EF628505 VERSION EF628505 KEYWORDS . SOURCE chloroplast Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; rosids; eurosids I; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine. REFERENCE 1 (bases 1 to 800) AUTHORS Khumaida,N., Sopandie,D. and Takano,T. TITLE Shade tolerance-related gene on soybean (Glycine max): homolog to psaD gene of PSI subunit JOURNAL Unpublished REFERENCE 2 (bases 1 to 800) AUTHORS Khumaida,N., Sopandie,D. and Takano,T. TITLE Direct Submission JOURNAL Submitted (21-MAY-2007) Agronomy and Horticulture, Faculty Of Agriculture, Bogor Agricultural University (IPB), Jl. Meranti, Kampus IPB Darmaga, Bogor, West Java 16680, Indonesia FEATURES Location/Qualifiers source 1..800 /organism="Glycine max" /organelle="plastid:chloroplast" /mol_type="mRNA" /db_xref="taxon:3847" gene 1..800 /gene="psaD" /note="gmpsaD" CDS 27..659 /gene="psaD" /note="PS-1 subunit; transport electron PSI; PsaD protein" /codon_start=1 /transl_table=11 /product="photosystem I subunit PsaD" /translation="MAMATQASLLTPPLSGLKASDRASVPWKQNSSLSF SSPKPLKFSRTIRAAAADETTEAPAKVEAAPVGFTPPELDPNTPSPIF GGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKL ARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA GRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL" ORIGIN 1 gaacacttgt attatctcaa gcaaccatgg caatggcaac ccaagcctct ctcttaaccc 61 cacccctctc cggtctcaaa gccagcgacc gcgcctccgt gccatggaag caaaactcca 121 gcctctcctt ctccagcccg aagcccctca agttctccag aacaatcaga gcagcagccg 181 ccgacgagac cacagaggca ccagcaaaag tagaggctgc accggtcggg ttcaccccac 241 cagaacttga cccaaacacc ccttccccga tcttcggggg cagcaccggc gggctcctgc 301 gcaaggcaca ggtggaggag ttttatgtca ttacgtggga ctcacccaaa gaacagatct 361 ttgaaatgcc cactggcggc gccgctatca tgagggaggg tcctaacctt ctcaagttgg 421 ccaggaagga gcagtgcttg gctcttggga ctaggctcag gtccaagtac aagatcaagt 481 accagttcta cagggtcttc cctaatgggg aggttcagta tttgcaccct aaggatggtg 541 tttaccctga gaaggtcaac gccggacgcc aaggggtggg tcaaaacttc aggtctattg 601 gtaagaatgt tagtcctatt gaggtcaagt tcactggcaa gcagccctat gatttgtgag 661 cacacaactc tatcttcatc atcatcatcc cccgtgcttc ctttatatgc tatatattct 721 catgtgatat catgtaccta ttgtcaattt tattatgcca caaatattgc taaaaaaaaa 781 aaaaaaaaaa aaaaaaaaaa //
148
